Lineage for d6vk8d_ (6vk8 D:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2584614Fold d.137: Monooxygenase (hydroxylase) regulatory protein [56028] (1 superfamily)
    corner-like structure formed by two sheets and filled in with 2-3 helices
  4. 2584615Superfamily d.137.1: Monooxygenase (hydroxylase) regulatory protein [56029] (1 family) (S)
    duplication: consists of two beta-alpha-(beta)-beta(2) motifs; some topological similarity to the ferredoxin-like fold
  5. 2584616Family d.137.1.1: Monooxygenase (hydroxylase) regulatory protein [56030] (4 proteins)
    note: the solution structure determinations disagree in the relative orientations of two motifs
  6. 2584655Protein automated matches [190214] (3 species)
    not a true protein
  7. 2584656Species Methylosinus trichosporium [TaxId:595536] [392646] (7 PDB entries)
  8. 2584662Domain d6vk8d_: 6vk8 D: [392693]
    Other proteins in same PDB: d6vk8a_, d6vk8b_, d6vk8c_, d6vk8e_, d6vk8f_, d6vk8g_
    automated match to d1ckva_
    complexed with bez, edo, fe, sin

Details for d6vk8d_

PDB Entry: 6vk8 (more details), 2.03 Å

PDB Description: crystal structure of methylosinus trichosporium ob3b soluble methane monooxygenase hydroxylase and regulatory component complex with small organic carboxylate at active center
PDB Compounds: (D:) Methane monooxygenase regulatory protein B

SCOPe Domain Sequences for d6vk8d_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6vk8d_ d.137.1.1 (D:) automated matches {Methylosinus trichosporium [TaxId: 595536]}
ssahnaynagimqktgkafadeffaeenqvvhesnavvlvlmksdeidaiiedivlkggk
aknpsivvedkagfwwikadgaieidaaeagellgkpfsvydllinvsstvgraytlgtk
ftitselmgldr

SCOPe Domain Coordinates for d6vk8d_:

Click to download the PDB-style file with coordinates for d6vk8d_.
(The format of our PDB-style files is described here.)

Timeline for d6vk8d_: