SCOPe 2.01: Domain d1dhma_: 1dhm A:

Lineage for d1dhma_ (1dhm A:)

1. Root: SCOPe 2.01

2. Class d: Alpha and beta proteins (a+b) [53931] (376 folds)

3. Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family)

5. Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)

6. Protein Papillomavirus-1 E2 protein [54959] (5 species)
   forms dimers with subunit beta-sheets making (8,12) barrel

7. Species Human papillomavirus type 31 [TaxId:10585] [54961] (2 PDB entries)

8. Domain d1dhma_: 1dhm A: [39221]

Details for d1dhma_

PDB Entry: 1dhm

PDB Description: dna-binding domain of e2 from human papillomavirus-31, nmr, minimized average structure

PDB Compounds: (A:) e2 protein

SCOPe Domain Sequences for d1dhma_:

Sequence; same for both SEQRES and ATOM records:

>d1dhma_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 31 [TaxId: 10585]}
mattpiihlkgdanilkclryrlskykqlyeqvsstwhwtctdgkhknaivtltyistsq
rddflntvkipntvsvstgymti

Timeline for d1dhma_:

• d1dhma_ first appeared (with stable ids) in SCOP 1.55
  
• d1dhma_ appears in SCOP 1.75
  
• d1dhma_ appears in SCOPe 2.02
  
• d1dhma_ appears in the current release, SCOPe 2.08