Lineage for d1dhma_ (1dhm A:)

  1. Root: SCOPe 2.01
  2. 1013083Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 1026488Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1028445Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) (S)
  5. 1028446Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins)
  6. 1028453Protein Papillomavirus-1 E2 protein [54959] (5 species)
    forms dimers with subunit beta-sheets making (8,12) barrel
  7. 1028476Species Human papillomavirus type 31 [TaxId:10585] [54961] (2 PDB entries)
  8. 1028478Domain d1dhma_: 1dhm A: [39221]

Details for d1dhma_

PDB Entry: 1dhm (more details)

PDB Description: dna-binding domain of e2 from human papillomavirus-31, nmr, minimized average structure
PDB Compounds: (A:) e2 protein

SCOPe Domain Sequences for d1dhma_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1dhma_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Human papillomavirus type 31 [TaxId: 10585]}
mattpiihlkgdanilkclryrlskykqlyeqvsstwhwtctdgkhknaivtltyistsq
rddflntvkipntvsvstgymti

SCOPe Domain Coordinates for d1dhma_:

Click to download the PDB-style file with coordinates for d1dhma_.
(The format of our PDB-style files is described here.)

Timeline for d1dhma_:

View in 3D
Domains from other chains:
(mouse over for more information)
d1dhmb_