![]() | Class d: Alpha and beta proteins (a+b) [53931] (208 folds) |
![]() | Fold d.58: Ferredoxin-like [54861] (39 superfamilies) |
![]() | Superfamily d.58.8: Viral DNA-binding domain [54957] (1 family) ![]() |
![]() | Family d.58.8.1: Viral DNA-binding domain [54958] (2 proteins) |
![]() | Protein Papillomavirus-1 E2 protein [54959] (4 species) |
![]() | Species Bovine papillomavirus type 1 [TaxId:10559] [54960] (3 PDB entries) |
![]() | Domain d1dbda_: 1dbd A: [39218] |
PDB Entry: 1dbd (more details)
SCOP Domain Sequences for d1dbda_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1dbda_ d.58.8.1 (A:) Papillomavirus-1 E2 protein {Bovine papillomavirus type 1} rrttndgfhllkaggscfalisgtanqvkcyrfrvkknhrhryenctttwftvadngaer qgqaqilitfgspsqrqdflkhvplppgmnisgftasldf
Timeline for d1dbda_: