Lineage for d1fjca_ (1fjc A:)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2951860Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) (S)
  5. 2951861Family d.58.7.1: Canonical RBD [54929] (70 proteins)
    Pfam PF00076
    Pfam PF13893
  6. 2952022Protein Nucleolin [54952] (2 species)
  7. 2952023Species Golden hamster (Mesocricetus auratus) [TaxId:10036] [54953] (4 PDB entries)
  8. 2952026Domain d1fjca_: 1fjc A: [39212]
    RBD2

Details for d1fjca_

PDB Entry: 1fjc (more details)

PDB Description: solution structure of nucleolin rbd2
PDB Compounds: (A:) nucleolin rbd2

SCOPe Domain Sequences for d1fjca_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fjca_ d.58.7.1 (A:) Nucleolin {Golden hamster (Mesocricetus auratus) [TaxId: 10036]}
shmledpctskkvraartllaknlsfnitedelkevfedaleirlvsqdgkskgiayief
kseadaeknleekqgaeidgrsvslyytgekggtrg

SCOPe Domain Coordinates for d1fjca_:

Click to download the PDB-style file with coordinates for d1fjca_.
(The format of our PDB-style files is described here.)

Timeline for d1fjca_: