PDB entry 1fjc

View 1fjc on RCSB PDB site
Description: solution structure of nucleolin rbd2
Class: structural protein
Keywords: RNP, RBD, RRM, RNA binding domain, Nucleolus, structural protein
Deposited on 2000-08-07, released 2000-10-16
The last revision prior to the SCOPe 2.08 freeze date was dated 2009-02-24, with a file datestamp of 2009-02-03.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.01 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: nucleolin rbd2
    Species: Mesocricetus auratus [TaxId:10036]
    Database cross-references and differences (RAF-indexed):
    • Uniprot P08199 (0-95)
      • conflict (0-8)
      • conflict (92-95)
    Domains in SCOPe 2.08: d1fjca_

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1fjcA (A:)
    shmledpctskkvraartllaknlsfnitedelkevfedaleirlvsqdgkskgiayief
    kseadaeknleekqgaeidgrsvslyytgekggtrg