SCOPe 2.07: Domain d6tbob_: 6tbo B:

Lineage for d6tbob_ (6tbo B:)

1. Root: SCOPe 2.07

2. Class b: All beta proteins [48724] (178 folds)

3. Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
   barrel, closed; n=6, S=8; greek-key
   duplication: consists of two domains of the same fold

4. Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families)

5. Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)

6. Protein automated matches [190384] (21 species)
   not a true protein

7. Species Norwalk virus [TaxId:37129] [311216] (22 PDB entries)

8. Domain d6tbob_: 6tbo B: [391889]
   automated match to d2ipha_
   complexed with dms, n0e, po4

Details for d6tbob_

PDB Entry: 6tbo, 2.07 Å

PDB Description: 3c-like protease from southampton virus complexed with fmopl000363a.

PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d6tbob_:

Sequence; same for both SEQRES and ATOM records:

>d6tbob_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 37129]}
pptlwsrvtkfgsgwgfwvsptvfittthviptsakeffgepltsiaihrageftlfrfs
kkirpdltgmileegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgml
ltganakgmdlgtipgdcgapyvykrandwvvcgvhaaatksgntvvcavqa

Timeline for d6tbob_:

• d6tbob_ is new in SCOPe 2.07-stable
  
• d6tbob_ appears in the current release, SCOPe 2.08