SCOPe 2.08: Domain d1fxla2: 1fxl A:119-203

Lineage for d1fxla2 (1fxl A:119-203)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families)

5. Family d.58.7.1: Canonical RBD [54929] (70 proteins)
   Pfam PF00076
   Pfam PF13893

6. Protein Hu antigen D (Hud) [54942] (1 species)

7. Species Human (Homo sapiens) [TaxId:9606] [54943] (2 PDB entries)

8. Domain d1fxla2: 1fxl A:119-203 [39184]
   protein/RNA complex

Details for d1fxla2

PDB Entry: 1fxl, 1.8 Å

PDB Description: crystal structure of hud and au-rich element of the c-fos rna

PDB Compounds: (A:) paraneoplastic encephalomyelitis antigen hud

SCOPe Domain Sequences for d1fxla2:

Sequence; same for both SEQRES and ATOM records:

>d1fxla2 d.58.7.1 (A:119-203) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]}
sasirdanlyvsglpktmtqkeleqlfsqygriitsrilvdqvtgvsrgvgfirfdkrie
aeeaikglngqkpsgatepitvkfa

Timeline for d1fxla2:

• d1fxla2 first appeared (with stable ids) in SCOP 1.55
  
• d1fxla2 appears in SCOPe 2.07