Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.7: RNA-binding domain, RBD, aka RNA recognition motif (RRM) [54928] (6 families) |
Family d.58.7.1: Canonical RBD [54929] (70 proteins) Pfam PF00076 Pfam PF13893 |
Protein Hu antigen D (Hud) [54942] (1 species) |
Species Human (Homo sapiens) [TaxId:9606] [54943] (2 PDB entries) |
Domain d1fxla1: 1fxl A:37-118 [39183] protein/RNA complex |
PDB Entry: 1fxl (more details), 1.8 Å
SCOPe Domain Sequences for d1fxla1:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fxla1 d.58.7.1 (A:37-118) Hu antigen D (Hud) {Human (Homo sapiens) [TaxId: 9606]} sktnlivnylpqnmtqeefrslfgsigeiescklvrdkitgqslgygfvnyidpkdaeka intlnglrlqtktikvsyarps
Timeline for d1fxla1: