Lineage for d6t82b_ (6t82 B:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2404157Fold b.47: Trypsin-like serine proteases [50493] (1 superfamily)
    barrel, closed; n=6, S=8; greek-key
    duplication: consists of two domains of the same fold
  4. 2404158Superfamily b.47.1: Trypsin-like serine proteases [50494] (5 families) (S)
  5. 2406861Family b.47.1.4: Viral cysteine protease of trypsin fold [50603] (5 proteins)
  6. 2407160Protein automated matches [190384] (21 species)
    not a true protein
  7. 2407282Species Norwalk virus [TaxId:37129] [311216] (22 PDB entries)
  8. 2407290Domain d6t82b_: 6t82 B: [391812]
    automated match to d2ipha_
    complexed with dms, muk, po4

Details for d6t82b_

PDB Entry: 6t82 (more details), 1.46 Å

PDB Description: 3c-like protease from southampton virus complexed with fmopl000542a.
PDB Compounds: (B:) Genome polyprotein

SCOPe Domain Sequences for d6t82b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6t82b_ b.47.1.4 (B:) automated matches {Norwalk virus [TaxId: 37129]}
ptlwsrvtkfgsgwgfwvsptvfittthviptsakeffgepltsiaihrageftlfrfsk
kirpdltgmileegcpegtvcsvlikrdsgellplavrmgaiasmriqgrlvhgqsgmll
tganakgmdlgtipgdcgapyvykrandwvvcgvhaaatksgntvvcavqa

SCOPe Domain Coordinates for d6t82b_:

Click to download the PDB-style file with coordinates for d6t82b_.
(The format of our PDB-style files is described here.)

Timeline for d6t82b_: