Class a: All alpha proteins [46456] (289 folds) |
Fold a.104: Cytochrome P450 [48263] (1 superfamily) multihelical |
Superfamily a.104.1: Cytochrome P450 [48264] (2 families) |
Family a.104.1.0: automated matches [191509] (1 protein) not a true family |
Protein automated matches [190847] (95 species) not a true protein |
Species Mycobacterium tuberculosis [TaxId:83332] [226004] (22 PDB entries) |
Domain d6t0ha1: 6t0h A:1-428 [391716] Other proteins in same PDB: d6t0ha2 automated match to d2wm5a_ complexed with cl, gol, hem, m9b, mg, pge |
PDB Entry: 6t0h (more details), 1.18 Å
SCOPe Domain Sequences for d6t0ha1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6t0ha1 a.104.1.0 (A:1-428) automated matches {Mycobacterium tuberculosis [TaxId: 83332]} mglntaiatrvngtpppevpiadielgsldfwaldddvrdgafatlrreapisfwptiel pgfvagnghwaltkyddvfyasrhpdifssypnitindqtpelaeyfgsmivlddprhqr lrsivsraftpkvvarieaavrdrahrlvssmiannpdrqadlvselagplplqiicdmm gipkadhqrifhwtnvilgfgdpdlatdfdefmqvsadigayatalaedrrvnhhddlts slveaevdgerlssreiasffillvvagnettrnaithgvlalsrypeqrdrwwsdfdgl aptaveeivrwaspvvymrrtltqdielrgtkmaagdkvslwycsanrdeskfadpwtfd larnpnphlgfggggahfclganlarreirvafdelrrqmpdvvateeparllsqfihgi ktlpvtws
Timeline for d6t0ha1: