Lineage for d1fht__ (1fht -)
- Root: SCOP 1.57
Class d: Alpha and beta proteins (a+b) [53931] (194 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.7: RNA-binding domain, RBD [54928] (3 families) 
Family d.58.7.1: Canonical RBD [54929] (13 proteins) 
Protein Splicesomal U1A protein [54932] (1 species) Species Human (Homo sapiens) [TaxId:9606] [54933] (9 PDB entries) 
Domain d1fht__: 1fht - [39157]
Details for d1fht__
PDB Entry: 1fht (more details)
PDB Description: rna-binding domain of the u1a spliceosomal protein u1a117, nmr, 43 structures
SCOP Domain Sequences for d1fht__:
Sequence; same for both SEQRES and ATOM records: (download)
>d1fht__ d.58.7.1 (-) Splicesomal U1A protein {Human (Homo sapiens)}
avpetrpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfverdrkrekrkpksqe
SCOP Domain Coordinates for d1fht__:
Click to download the PDB-style file with coordinates for d1fht__.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1fht__:
- d1fht__ first appeared (with stable ids) in SCOP 1.55
- d1fht__ appears in SCOP 1.59
- d1fht__ appears in the current release, SCOPe 2.08, called d1fhta_
View in 3D