Lineage for d1fht__ (1fht -)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32639Superfamily d.58.7: RNA-binding domain, RBD [54928] (2 families) (S)
  5. 32640Family d.58.7.1: Canonical RBD [54929] (12 proteins)
  6. Protein Splicesomal U1A protein [54932] (1 species)
  7. Species Human (Homo sapiens) [TaxId:9606] [54933] (8 PDB entries)
  8. 32722Domain d1fht__: 1fht - [39157]

Details for d1fht__

PDB Entry: 1fht (more details)

PDB Description: rna-binding domain of the u1a spliceosomal protein u1a117, nmr, 43 structures

SCOP Domain Sequences for d1fht__:

Sequence; same for both SEQRES and ATOM records: (download)

>d1fht__ d.58.7.1 (-) Splicesomal U1A protein {Human (Homo sapiens)}
avpetrpnhtiyinnlnekikkdelkkslyaifsqfgqildilvsrslkmrgqafvifke
vssatnalrsmqgfpfydkpmriqyaktdsdiiakmkgtfverdrkrekrkpksqe

SCOP Domain Coordinates for d1fht__:

Click to download the PDB-style file with coordinates for d1fht__.
(The format of our PDB-style files is described here.)

Timeline for d1fht__: