Lineage for d6sgve_ (6sgv E:)

  1. Root: SCOPe 2.08
  2. 2739516Class b: All beta proteins [48724] (180 folds)
  3. 2819475Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. 2819476Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. 2819945Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. 2819946Protein automated matches [193506] (5 species)
    not a true protein
  7. 2819947Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. 2820217Domain d6sgve_: 6sgv E: [391512]
    automated match to d2w8gc_
    complexed with act, ldq, nag

Details for d6sgve_

PDB Entry: 6sgv (more details), 2.6 Å

PDB Description: crystal structure of acachbp in complex with hosieine
PDB Compounds: (E:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d6sgve_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6sgve_ b.96.1.0 (E:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrer

SCOPe Domain Coordinates for d6sgve_:

Click to download the PDB-style file with coordinates for d6sgve_.
(The format of our PDB-style files is described here.)

Timeline for d6sgve_: