Lineage for d2w8gc_ (2w8g C:)

  1. Root: SCOPe 2.08
  2. Class b: All beta proteins [48724] (180 folds)
  3. Fold b.96: Nicotinic receptor ligand binding domain-like [63711] (1 superfamily)
    sandwich; 8 strands in 2 sheets; greek-key: partial topological similarity to immunoglobulin-like folds
  4. Superfamily b.96.1: Nicotinic receptor ligand binding domain-like [63712] (2 families) (S)
  5. Family b.96.1.0: automated matches [193505] (1 protein)
    not a true family
  6. Protein automated matches [193506] (5 species)
    not a true protein
  7. Species California sea hare (Aplysia californica) [TaxId:6500] [230583] (67 PDB entries)
  8. Domain d2w8gc_: 2w8g C: [244044]
    automated match to d2c9tc_
    complexed with bs2

Details for d2w8gc_

PDB Entry: 2w8g (more details), 2.6 Å

PDB Description: aplysia californica achbp bound to in silico compound 35
PDB Compounds: (C:) Soluble acetylcholine receptor

SCOPe Domain Sequences for d2w8gc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2w8gc_ b.96.1.0 (C:) automated matches {California sea hare (Aplysia californica) [TaxId: 6500]}
qanlmrlksdlfnrspmypgptkddpltvtlgftlqdivkvdsstnevdlvyyeqqrwkl
nslmwdpneygnitdfrtsaadiwtpditaysstrpvqvlspqiavvthdgsvmfipaqr
lsfmcdptgvdseegvtcavkfgswvysgfeidlktdtdqvdlssyyasskyeilsatqt
rqvqhysccpepyidvnlvvkfrerragngffrnlfd

SCOPe Domain Coordinates for d2w8gc_ are not available.

Timeline for d2w8gc_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2w8ga_, d2w8gb_, d2w8gd_, d2w8ge_