Class d: Alpha and beta proteins (a+b) [53931] (376 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (2 families) |
Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (2 proteins) |
Protein Nucleoside diphosphate kinase, NDK [54921] (21 species) |
Species Myxococcus xanthus [TaxId:34] [54927] (3 PDB entries) |
Domain d1nlkr_: 1nlk R: [39145] complexed with adp, mg |
PDB Entry: 1nlk (more details), 2 Å
SCOPe Domain Sequences for d1nlkr_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nlkr_ d.58.6.1 (R:) Nucleoside diphosphate kinase, NDK {Myxococcus xanthus [TaxId: 34]} aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds lenakieiayffreteihsypyq
Timeline for d1nlkr_: