Lineage for d2nckl_ (2nck L:)

  1. Root: SCOP 1.65
  2. 323018Class d: Alpha and beta proteins (a+b) [53931] (234 folds)
  3. 328742Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 329033Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) (S)
  5. 329034Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)
  6. 329035Protein Nucleoside diphosphate kinases [54921] (9 species)
  7. 329131Species Myxococcus xanthus [TaxId:34] [54927] (3 PDB entries)
  8. 329134Domain d2nckl_: 2nck L: [39144]

Details for d2nckl_

PDB Entry: 2nck (more details), 2 Å

PDB Description: crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution

SCOP Domain Sequences for d2nckl_:

Sequence; same for both SEQRES and ATOM records: (download)

>d2nckl_ d.58.6.1 (L:) Nucleoside diphosphate kinases {Myxococcus xanthus}
aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
lenakieiayffreteihsypyq

SCOP Domain Coordinates for d2nckl_:

Click to download the PDB-style file with coordinates for d2nckl_.
(The format of our PDB-style files is described here.)

Timeline for d2nckl_:

View in 3D
Domains from other chains:
(mouse over for more information)
d2nckr_