SCOP 1.63: Domain d2nckl_: 2nck L:

Lineage for d2nckl_ (2nck L:)

1. Root: SCOP 1.63

2. Class d: Alpha and beta proteins (a+b) [53931] (224 folds)

3. Fold d.58: Ferredoxin-like [54861] (44 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)

6. Protein Nucleoside diphosphate kinases [54921] (8 species)

7. Species Myxococcus xanthus [TaxId:34] [54927] (3 PDB entries)

8. Domain d2nckl_: 2nck L: [39144]

Details for d2nckl_

PDB Entry: 2nck, 2 Å

PDB Description: crystal structure of myxococcus xanthus nucleoside diphosphate kinase and its interaction with a nucleotide substrate at 2.0 angstroms resolution

SCOP Domain Sequences for d2nckl_:

Sequence; same for both SEQRES and ATOM records:

>d2nckl_ d.58.6.1 (L:) Nucleoside diphosphate kinases {Myxococcus xanthus}
aiertlsiikpdglekgvigkiisrfeekglkpvairlqhlsqaqaegfyavhkarpffk
dlvqfmisgpvvlmvlegenavlanrdimgatnpaqaaegtirkdfatsidkntvhgsds
lenakieiayffreteihsypyq

Timeline for d2nckl_:

• d2nckl_ first appeared (with stable ids) in SCOP 1.55
  
• d2nckl_ appears in SCOP 1.61
  
• d2nckl_ appears in SCOP 1.65
  
• d2nckl_ appears in the current release, SCOPe 2.08