SCOPe 2.08: Domain d6rqya1: 6rqy A:1-299

Lineage for d6rqya1 (6rqy A:1-299)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families)
   dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers

5. Family d.58.4.0: automated matches [191316] (1 protein)
   not a true family

6. Protein automated matches [190081] (33 species)
   not a true protein

7. Species Klebsiella pneumoniae [TaxId:573] [355716] (12 PDB entries)

8. Domain d6rqya1: 6rqy A:1-299 [391401]
   Other proteins in same PDB: d6rqya2, d6rqya3, d6rqyb2
   automated match to d5vj0a_
   complexed with gol, hem, mg

Details for d6rqya1

PDB Entry: 6rqy, 1.9 Å

PDB Description: structure of % reduced kpdyp

PDB Compounds: (A:) Iron-dependent peroxidase

SCOPe Domain Sequences for d6rqya1:

Sequence; same for both SEQRES and ATOM records:

>d6rqya1 d.58.4.0 (A:1-299) automated matches {Klebsiella pneumoniae [TaxId: 573]}
msqvqsgilpehcraaiwieanlkgdvnalreaskifvdnvatfqakfpdaklgavvafg
nnvwrqlsggegadelkdfpvygkglapstqydllihilsarhevnfsvaqaalaafgda
idvkeeihgfrwveerdlsgfvdgtenpageetrrevavikdgvdaggsyvfvqrwehnl
kqlnrmsvpdqemmigrtkdaneeidgderpvtshlsrvdlkedgkglkivrqslpygta
sgthglyfcaycarlynieqqllsmfgdtdgkrdamlrftkpvtggyyfapsleriqal

Timeline for d6rqya1:

• d6rqya1 first appeared in SCOPe 2.07