Lineage for d6qbva_ (6qbv A:)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2883383Fold c.55: Ribonuclease H-like motif [53066] (7 superfamilies)
    3 layers: a/b/a; mixed beta-sheet of 5 strands, order 32145; strand 2 is antiparallel to the rest
  4. 2885833Superfamily c.55.3: Ribonuclease H-like [53098] (18 families) (S)
    consists of one domain of this fold
  5. 2887216Family c.55.3.0: automated matches [191357] (1 protein)
    not a true family
  6. 2887217Protein automated matches [190396] (40 species)
    not a true protein
  7. 2887455Species Human t-cell leukemia virus 2 [TaxId:11909] [391218] (3 PDB entries)
  8. 2887458Domain d6qbva_: 6qbv A: [391222]
    automated match to d5cz2a_
    complexed with mg

Details for d6qbva_

PDB Entry: 6qbv (more details), 2.45 Å

PDB Description: structure of the htlv-2 integrase catalytic core domain in complex with magnesium (dimeric form)
PDB Compounds: (A:) integrase

SCOPe Domain Sequences for d6qbva_:

Sequence, based on SEQRES records: (download)

>d6qbva_ c.55.3.0 (A:) automated matches {Human t-cell leukemia virus 2 [TaxId: 11909]}
rgllpnhiwqgdvthykykkykyclhvwvdtfsgavsvsckkketscetisaflqaisll
gkplhintdngpaflsqefqefctsyhikhsthipynptssglvertngiiknllnkyll
dcpnlpldnainkalwtlnqlnvmnpsgktrwqihhsp

Sequence, based on observed residues (ATOM records): (download)

>d6qbva_ c.55.3.0 (A:) automated matches {Human t-cell leukemia virus 2 [TaxId: 11909]}
rgllpnhiwqgdvthykykkykyclhvwvdtfsgavsvsckkketscetisaflqaisll
gkplhintdngpaflsqefqefctsyhikhsthvertngiiknllnkylldcpnlpldna
inkalwtlnqlnvmsgktrwqihhsp

SCOPe Domain Coordinates for d6qbva_:

Click to download the PDB-style file with coordinates for d6qbva_.
(The format of our PDB-style files is described here.)

Timeline for d6qbva_: