Lineage for d1lwxb_ (1lwx B:)

  1. Root: SCOP 1.75
  2. 849709Class d: Alpha and beta proteins (a+b) [53931] (376 folds)
  3. 861003Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 861820Superfamily d.58.6: Nucleoside diphosphate kinase, NDK [54919] (1 family) (S)
  5. 861821Family d.58.6.1: Nucleoside diphosphate kinase, NDK [54920] (1 protein)
  6. 861822Protein Nucleoside diphosphate kinase, NDK [54921] (20 species)
  7. 861868Species Dictyostelium discoideum [TaxId:44689] [54925] (22 PDB entries)
  8. 861898Domain d1lwxb_: 1lwx B: [39120]

Details for d1lwxb_

PDB Entry: 1lwx (more details), 2.3 Å

PDB Description: azt diphosphate binding to nucleoside diphosphate kinase
PDB Compounds: (B:) Nucleoside diphosphate kinase

SCOP Domain Sequences for d1lwxb_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1lwxb_ d.58.6.1 (B:) Nucleoside diphosphate kinase, NDK {Dictyostelium discoideum [TaxId: 44689]}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgraiihgsd
svesanreialwfkpeelltevkpnpnlye

SCOP Domain Coordinates for d1lwxb_:

Click to download the PDB-style file with coordinates for d1lwxb_.
(The format of our PDB-style files is described here.)

Timeline for d1lwxb_: