SCOP 1.61: Domain d2befc_: 2bef C:

Lineage for d2befc_ (2bef C:)

1. Root: SCOP 1.61

2. Class d: Alpha and beta proteins (a+b) [53931] (212 folds)

3. Fold d.58: Ferredoxin-like [54861] (40 superfamilies)

4. Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)

6. Protein Nucleoside diphosphate kinases [54921] (8 species)

7. Species Dictyostelium discoideum [TaxId:44689] [54925] (18 PDB entries)

8. Domain d2befc_: 2bef C: [39117]

Details for d2befc_

PDB Entry: 2bef, 2.3 Å

PDB Description: crystal structure of ndp kinase complexed with mg, adp, and bef3

SCOP Domain Sequences for d2befc_:

Sequence; same for both SEQRES and ATOM records:

>d2befc_ d.58.6.1 (C:) Nucleoside diphosphate kinases {Dictyostelium discoideum}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

Timeline for d2befc_:

• d2befc_ first appeared (with stable ids) in SCOP 1.55
  
• d2befc_ appears in SCOP 1.59
  
• d2befc_ appears in SCOP 1.63
  
• d2befc_ appears in the current release, SCOPe 2.08