SCOPe 2.08: Domain d6ojfa_: 6ojf A:

Lineage for d6ojfa_ (6ojf A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.37: P-loop containing nucleoside triphosphate hydrolases [52539] (1 superfamily)
   3 layers: a/b/a, parallel or mixed beta-sheets of variable sizes

4. Superfamily c.37.1: P-loop containing nucleoside triphosphate hydrolases [52540] (27 families)
   division into families based on beta-sheet topologies

5. Family c.37.1.0: automated matches [191323] (1 protein)
   not a true family

6. Protein automated matches [190123] (158 species)
   not a true protein

7. Species Human (Homo sapiens) [TaxId:9606] [186862] (207 PDB entries)

8. Domain d6ojfa_: 6ojf A: [391139]
   automated match to d3w3zb_
   complexed with gdp, mg

Details for d6ojfa_

PDB Entry: 6ojf, 1.6 Å

PDB Description: dimeric structure of lrrk2 gtpase domain

PDB Compounds: (A:) Leucine-rich repeat serine/threonine-protein kinase 2

SCOPe Domain Sequences for d6ojfa_:

Sequence; same for both SEQRES and ATOM records:

>d6ojfa_ c.37.1.0 (A:) automated matches {Human (Homo sapiens) [TaxId: 9606]}
ynrmklmivgntgsgkttllqqlmktkksdlgmqsatvgidvkdwpiqirdkrkrdlvln
vwdfagreefysthphfmtqralylavydlskgqaevdamkpwlfnikarassspvilvg
thldvsdeaqraacmskitkellnkrgfpairdyhfvnateesdalaklrktiineslnf
kirdqlvv

Timeline for d6ojfa_:

• d6ojfa_ first appeared in SCOPe 2.07