SCOP 1.65: Domain d1kdnc_: 1kdn C:

Lineage for d1kdnc_ (1kdn C:)

1. Root: SCOP 1.65

2. Class d: Alpha and beta proteins (a+b) [53931] (234 folds)

3. Fold d.58: Ferredoxin-like [54861] (48 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family)

5. Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)

6. Protein Nucleoside diphosphate kinases [54921] (9 species)

7. Species Dictyostelium discoideum [TaxId:44689] [54925] (20 PDB entries)

8. Domain d1kdnc_: 1kdn C: [39107]
   complexed with adp, af3, mg

Details for d1kdnc_

PDB Entry: 1kdn, 2 Å

PDB Description: structure of nucleoside diphosphate kinase

SCOP Domain Sequences for d1kdnc_:

Sequence; same for both SEQRES and ATOM records:

>d1kdnc_ d.58.6.1 (C:) Nucleoside diphosphate kinases {Dictyostelium discoideum}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

Timeline for d1kdnc_:

• d1kdnc_ first appeared (with stable ids) in SCOP 1.55
  
• d1kdnc_ appears in SCOP 1.63
  
• d1kdnc_ appears in SCOP 1.67
  
• d1kdnc_ appears in the current release, SCOPe 2.08