Lineage for d1kdnc_ (1kdn C:)

  1. Root: SCOP 1.55
  2. 28523Class d: Alpha and beta proteins (a+b) [53931] (184 folds)
  3. 32366Fold d.58: Ferredoxin-like [54861] (36 superfamilies)
  4. 32559Superfamily d.58.6: Nucleoside diphosphate kinases [54919] (1 family) (S)
  5. 32560Family d.58.6.1: Nucleoside diphosphate kinases [54920] (1 protein)
  6. 32561Protein Nucleoside diphosphate kinases [54921] (6 species)
  7. 32572Species Dictyostelium discoideum [TaxId:44689] [54925] (16 PDB entries)
  8. 32580Domain d1kdnc_: 1kdn C: [39107]

Details for d1kdnc_

PDB Entry: 1kdn (more details), 2 Å

PDB Description: structure of nucleoside diphosphate kinase

SCOP Domain Sequences for d1kdnc_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1kdnc_ d.58.6.1 (C:) Nucleoside diphosphate kinases {Dictyostelium discoideum}
vnkertflavkpdgvarglvgeiiaryekkgfvlvglkqlvptkdlaeshyaehkerpff
gglvsfitsgpvvamvfegkgvvasarlmigvtnplasapgsirgdfgvdvgrniihgsd
svesanreialwfkpeelltevkpnpnlye

SCOP Domain Coordinates for d1kdnc_:

Click to download the PDB-style file with coordinates for d1kdnc_.
(The format of our PDB-style files is described here.)

Timeline for d1kdnc_: