Lineage for d6lmsa_ (6lms A:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2397497Fold b.40: OB-fold [50198] (17 superfamilies)
    barrel, closed or partly opened n=5, S=10 or S=8; greek-key
  4. 2398897Superfamily b.40.4: Nucleic acid-binding proteins [50249] (18 families) (S)
  5. 2399296Family b.40.4.5: Cold shock DNA-binding domain-like [50282] (32 proteins)
    barrel, closed; n=5, S=8
  6. 2399782Protein automated matches [190915] (12 species)
    not a true protein
  7. 2399785Species Homo sapiens [TaxId:9606] [369483] (2 PDB entries)
  8. 2399787Domain d6lmsa_: 6lms A: [390910]
    automated match to d1h95a_

Details for d6lmsa_

PDB Entry: 6lms (more details)

PDB Description: solution nmr structure cold shock domain of yb1 from homo sapiens
PDB Compounds: (A:) Y-box-binding protein 1

SCOPe Domain Sequences for d6lmsa_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lmsa_ b.40.4.5 (A:) automated matches {Homo sapiens [TaxId: 9606]}
dkkviatkvlgtvkwfnvrngygfinrndtkedvfvhqtaikknnprkylrsvgdgetve
fdvvegekgaeaanvtgpggvpvqgskyaa

SCOPe Domain Coordinates for d6lmsa_:

Click to download the PDB-style file with coordinates for d6lmsa_.
(The format of our PDB-style files is described here.)

Timeline for d6lmsa_: