Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) |
Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
Protein automated matches [190069] (319 species) not a true protein |
Species Streptococcus pneumoniae [TaxId:373153] [390711] (5 PDB entries) |
Domain d6l2ka1: 6l2k A:2-183 [390799] Other proteins in same PDB: d6l2ka2, d6l2kb2 automated match to d4kqxb1 complexed with gol, so4 |
PDB Entry: 6l2k (more details), 1.95 Å
SCOPe Domain Sequences for d6l2ka1:
Sequence; same for both SEQRES and ATOM records: (download)
>d6l2ka1 c.2.1.0 (A:2-183) automated matches {Streptococcus pneumoniae [TaxId: 373153]} tvqmeyekdvkvaaldgkkiavigygsqghahaqnlrdsgrdviigvepgksfdkakedg fdtytvaeatkladvimilapdeiqqelyeaeiapnleagnavgfahgfnihfefikvpa dvdvfmcapkgpghlvrrtyeegfgvpalyavyqdatgnakniamdwckgvgaarvglle tt
Timeline for d6l2ka1: