Lineage for d6l2ka1 (6l2k A:2-183)

  1. Root: SCOPe 2.08
  2. 2826024Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2841004Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
    core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
    The nucleotide-binding modes of this and the next two folds/superfamilies are similar
  4. 2841005Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) (S)
  5. 2845793Family c.2.1.0: automated matches [191313] (1 protein)
    not a true family
  6. 2845794Protein automated matches [190069] (319 species)
    not a true protein
  7. 2848638Species Streptococcus pneumoniae [TaxId:373153] [390711] (5 PDB entries)
  8. 2848641Domain d6l2ka1: 6l2k A:2-183 [390799]
    Other proteins in same PDB: d6l2ka2, d6l2kb2
    automated match to d4kqxb1
    complexed with gol, so4

Details for d6l2ka1

PDB Entry: 6l2k (more details), 1.95 Å

PDB Description: ilvc, a ketol-acid reductoisomerase, from streptococcus pneumoniae_r49e
PDB Compounds: (A:) Ketol-acid reductoisomerase (NADP(+))

SCOPe Domain Sequences for d6l2ka1:

Sequence; same for both SEQRES and ATOM records: (download)

>d6l2ka1 c.2.1.0 (A:2-183) automated matches {Streptococcus pneumoniae [TaxId: 373153]}
tvqmeyekdvkvaaldgkkiavigygsqghahaqnlrdsgrdviigvepgksfdkakedg
fdtytvaeatkladvimilapdeiqqelyeaeiapnleagnavgfahgfnihfefikvpa
dvdvfmcapkgpghlvrrtyeegfgvpalyavyqdatgnakniamdwckgvgaarvglle
tt

SCOPe Domain Coordinates for d6l2ka1:

Click to download the PDB-style file with coordinates for d6l2ka1.
(The format of our PDB-style files is described here.)

Timeline for d6l2ka1:

View in 3D
Domains from same chain:
(mouse over for more information)
d6l2ka2