SCOPe 2.08: Domain d6l2la1: 6l2l A:2-147

Lineage for d6l2la1 (6l2l A:2-147)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.97: Cytidine deaminase-like [53926] (2 superfamilies)
   core: alpha-beta(2)-(alpha-beta)2; 3 layers (a/b/a); mixed beta-sheet of 4 strands, order 2134; strand 1 is antiparallel to the rest

4. Superfamily c.97.1: Cytidine deaminase-like [53927] (7 families)
   contains extra C-terminal strand 5, order 21345

5. Family c.97.1.0: automated matches [191471] (1 protein)
   not a true family

6. Protein automated matches [190746] (16 species)
   not a true protein

7. Species Mycoplasma capricolum [TaxId:40479] [390788] (1 PDB entry)

8. Domain d6l2la1: 6l2l A:2-147 [390789]
   Other proteins in same PDB: d6l2la2
   automated match to d2b3jd_
   complexed with zn

Details for d6l2la1

PDB Entry: 6l2l, 2.4 Å

PDB Description: the structure of the trna-specific deaminase from m. capricolum

PDB Compounds: (A:) Nucleoside deaminase family protein

SCOPe Domain Sequences for d6l2la1:

Sequence, based on SEQRES records:

>d6l2la1 c.97.1.0 (A:2-147) automated matches {Mycoplasma capricolum [TaxId: 40479]}
ddfnnildllineskkaikhndipvscciidsnnnilslainsryknkdisqhaeinvin
dlisklnsfnlskyklittlepcmmcysaikqvkintiyylvdsykfgiknnysindqnl
nliqiknqkkqseyikllniffinkr

Sequence, based on observed residues (ATOM records):

>d6l2la1 c.97.1.0 (A:2-147) automated matches {Mycoplasma capricolum [TaxId: 40479]}
ddfnnildllineskkaikhndipvscciidsnnnilslainsryknkdisqhaeinvin
dlisklnsfnlskyklittlepcmmcysaikqvkintiyylvdsykfgiknnyqnlnliq
iknqkkqseyikllniffinkr

Timeline for d6l2la1:

• d6l2la1 first appeared in SCOPe 2.07