SCOPe 2.08: Domain d6kytb1: 6kyt B:1-118

Lineage for d6kytb1 (6kyt B:1-118)

1. Root: SCOPe 2.08

2. Class b: All beta proteins [48724] (180 folds)

3. Fold b.34: SH3-like barrel [50036] (21 superfamilies)
   barrel, partly opened; n*=4, S*=8; meander
   the last strand is interrupted by a turn of 3-10 helix

4. Superfamily b.34.6: Cell growth inhibitor/plasmid maintenance toxic component [50118] (4 families)
   contains insert beta-sheet subdomain and C-terminal helix

5. Family b.34.6.0: automated matches [328522] (1 protein)
   not a true family

6. Protein automated matches [328523] (5 species)
   not a true protein

7. Species Mycobacterium tuberculosis [TaxId:83332] [328524] (7 PDB entries)

8. Domain d6kytb1: 6kyt B:1-118 [390744]
   Other proteins in same PDB: d6kytb2, d6kytd2, d6kytg2, d6kyth2, d6kytj2, d6kytk2
   automated match to d5hk0a_
   protein/RNA complex

Details for d6kytb1

PDB Entry: 6kyt, 2 Å

PDB Description: the structure of the m. tb toxin mazef-mt1 complex

PDB Compounds: (B:) Endoribonuclease MazF9

SCOPe Domain Sequences for d6kytb1:

Sequence; same for both SEQRES and ATOM records:

>d6kytb1 b.34.6.0 (B:1-118) automated matches {Mycobacterium tuberculosis [TaxId: 83332]}
mmrrgeiwqvdldpargseannqrpavvvsndranatatrlgrgvitvvpvtsniakvyp
fqvllsatttglqvdckaqaeqirsiaterllrpigrvsaaelaqldealklhldlws

Timeline for d6kytb1:

• d6kytb1 first appeared in SCOPe 2.07