Lineage for d1gnka_ (1gnk A:)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1651257Superfamily d.58.5: GlnB-like [54913] (6 families) (S)
    form timeric structures with the orthogonally packed beta-sheets
  5. 1651258Family d.58.5.1: Prokaryotic signal transducing protein [54914] (4 proteins)
  6. 1651319Protein PII-homolog GlnK [54917] (2 species)
  7. 1651320Species Escherichia coli [TaxId:562] [54918] (3 PDB entries)
  8. 1651321Domain d1gnka_: 1gnk A: [39073]
    complexed with so4

Details for d1gnka_

PDB Entry: 1gnk (more details), 2 Å

PDB Description: glnk, a signal protein from e. coli
PDB Compounds: (A:) protein (glnk)

SCOPe Domain Sequences for d1gnka_:

Sequence, based on SEQRES records: (download)

>d1gnka_ d.58.5.1 (A:) PII-homolog GlnK {Escherichia coli [TaxId: 562]}
mklvtviikpfkledvrealssigiqgltvtevkgfgrqkghaelyrgaeysvnflpkvk
idvaiaddqldevidivskaaytgkigdgkifvaelqrvirirtgeadeaal

Sequence, based on observed residues (ATOM records): (download)

>d1gnka_ d.58.5.1 (A:) PII-homolog GlnK {Escherichia coli [TaxId: 562]}
mklvtviikpfkledvrealssigiqgltvtevkgfgrvnflpkvkidvaiaddqldevi
divskaaytgkigdgkifvaelqrvirirtgeadeaal

SCOPe Domain Coordinates for d1gnka_:

Click to download the PDB-style file with coordinates for d1gnka_.
(The format of our PDB-style files is described here.)

Timeline for d1gnka_: