Lineage for d1nsaa2 (1nsa A:7A-95A)
- Root: SCOPe 2.08
Class d: Alpha and beta proteins (a+b) [53931] (396 folds) 
Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) 
Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) Protein Procarboxypeptidase B [54903] (2 species) 
Species Pig (Sus scrofa) [TaxId:9823] [54904] (2 PDB entries) 
Domain d1nsaa2: 1nsa A:7A-95A [39066]
Other proteins in same PDB: d1nsaa1
complexed with ben, zn
Details for d1nsaa2
PDB Entry: 1nsa (more details), 2.3 Å
PDB Description: three-dimensional structure of porcine procarboxypeptidase b: a structural basis of its inactivity
PDB Compounds: (A:) Procarboxypeptidase BSCOPe Domain Sequences for d1nsaa2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nsaa2 d.58.3.1 (A:7A-95A) Procarboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]}
fegekvfrvnvedendiselhelastrqidfwkpdsvtqikphstvdfrvkaedilaved
fleqnelqyevlinnlrsvleaqfdsvsr
SCOPe Domain Coordinates for d1nsaa2:
Click to download the PDB-style file with coordinates for d1nsaa2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nsaa2:
- d1nsaa2 first appeared (with stable ids) in SCOP 1.55, called d1nsa_2
- d1nsaa2 appears in SCOPe 2.07
View in 3D
