Lineage for d1nsaa2 (1nsa A:7A-95A)

  1. Root: SCOPe 2.08
  2. 2923792Class d: Alpha and beta proteins (a+b) [53931] (396 folds)
  3. 2949054Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 2949661Superfamily d.58.3: Protease propeptides/inhibitors [54897] (4 families) (S)
  5. 2949662Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)
  6. 2949675Protein Procarboxypeptidase B [54903] (2 species)
  7. 2949679Species Pig (Sus scrofa) [TaxId:9823] [54904] (2 PDB entries)
  8. 2949680Domain d1nsaa2: 1nsa A:7A-95A [39066]
    Other proteins in same PDB: d1nsaa1
    complexed with ben, zn

Details for d1nsaa2

PDB Entry: 1nsa (more details), 2.3 Å

PDB Description: three-dimensional structure of porcine procarboxypeptidase b: a structural basis of its inactivity
PDB Compounds: (A:) Procarboxypeptidase B

SCOPe Domain Sequences for d1nsaa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1nsaa2 d.58.3.1 (A:7A-95A) Procarboxypeptidase B {Pig (Sus scrofa) [TaxId: 9823]}
fegekvfrvnvedendiselhelastrqidfwkpdsvtqikphstvdfrvkaedilaved
fleqnelqyevlinnlrsvleaqfdsvsr

SCOPe Domain Coordinates for d1nsaa2:

Click to download the PDB-style file with coordinates for d1nsaa2.
(The format of our PDB-style files is described here.)

Timeline for d1nsaa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1nsaa1