Lineage for d1nsa_2 (1nsa 7A-95A)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.3: Protease propeptides [54897] (2 families) 
Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) 
Protein Procarboxypeptidase B [54903] (1 species) Species Pig (Sus scrofa) [TaxId:9823] [54904] (2 PDB entries) 
Domain d1nsa_2: 1nsa 7A-95A [39066]
Other proteins in same PDB: d1nsa_1
Details for d1nsa_2
PDB Entry: 1nsa (more details), 2.3 Å
PDB Description: three-dimensional structure of porcine procarboxypeptidase b: a structural basis of its inactivity
SCOP Domain Sequences for d1nsa_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nsa_2 d.58.3.1 (7A-95A) Procarboxypeptidase B {Pig (Sus scrofa)}
fegekvfrvnvedendiselhelastrqidfwkpdsvtqikphstvdfrvkaedilaved
fleqnelqyevlinnlrsvleaqfdsvsr
SCOP Domain Coordinates for d1nsa_2:
Click to download the PDB-style file with coordinates for d1nsa_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1nsa_2:
- d1nsa_2 appears in SCOP 1.57
- d1nsa_2 appears in the current release, SCOPe 2.08, called d1nsaa2
View in 3D
