Class d: Alpha and beta proteins (a+b) [53931] (184 folds) |
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) |
Superfamily d.58.3: Protease propeptides [54897] (2 families) |
Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) |
Protein Procarboxypeptidase B [54903] (1 species) |
Species Pig (Sus scrofa) [TaxId:9823] [54904] (2 PDB entries) |
Domain d1nsa_2: 1nsa 7A-95A [39066] Other proteins in same PDB: d1nsa_1 |
PDB Entry: 1nsa (more details), 2.3 Å
SCOP Domain Sequences for d1nsa_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1nsa_2 d.58.3.1 (7A-95A) Procarboxypeptidase B {Pig (Sus scrofa)} fegekvfrvnvedendiselhelastrqidfwkpdsvtqikphstvdfrvkaedilaved fleqnelqyevlinnlrsvleaqfdsvsr
Timeline for d1nsa_2: