SCOP 1.57: Domain d1pca_2: 1pca 4A-99A

Lineage for d1pca_2 (1pca 4A-99A)

1. Root: SCOP 1.57

2. Class d: Alpha and beta proteins (a+b) [53931] (194 folds)

3. Fold d.58: Ferredoxin-like [54861] (36 superfamilies)

4. Superfamily d.58.3: Protease propeptides [54897] (2 families)

5. Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins)

6. Protein Procarboxypeptidase A [54899] (3 species)

7. Species Pig (Sus scrofa) [TaxId:9823] [54900] (1 PDB entry)

8. Domain d1pca_2: 1pca 4A-99A [39063]
   Other proteins in same PDB: d1pca_1

Details for d1pca_2

PDB Entry: 1pca, 2 Å

PDB Description: three dimensional structure of porcine pancreatic procarboxypeptidase a. a comparison of the a and b zymogens and their determinants for inhibition and activation

SCOP Domain Sequences for d1pca_2:

Sequence; same for both SEQRES and ATOM records:

>d1pca_2 d.58.3.1 (4A-99A) Procarboxypeptidase A {Pig (Sus scrofa)}
kedfvghqvlrisvddeaqvqkvkeledlehlqldfwrgparpgfpidvrvpfpsiqavk
vfleahgirytimiedvqllldeeqeqmfasqgr

Timeline for d1pca_2:

• d1pca_2 first appeared (with stable ids) in SCOP 1.55
  
• d1pca_2 appears in SCOP 1.59
  
• d1pca_2 appears in the current release, SCOPe 2.08, called d1pcaa1