Lineage for d1pca_2 (1pca 4A-99A)
- Root: SCOP 1.55
Class d: Alpha and beta proteins (a+b) [53931] (184 folds) 
Fold d.58: Ferredoxin-like [54861] (36 superfamilies) 
Superfamily d.58.3: Protease propeptides [54897] (2 families) 
Family d.58.3.1: Pancreatic carboxypeptidase, activation domain [54898] (2 proteins) Protein Procarboxypeptidase A [54899] (3 species) 
Species Pig (Sus scrofa) [TaxId:9823] [54900] (1 PDB entry) 
Domain d1pca_2: 1pca 4A-99A [39063]
Other proteins in same PDB: d1pca_1
Details for d1pca_2
PDB Entry: 1pca (more details), 2 Å
PDB Description: three dimensional structure of porcine pancreatic procarboxypeptidase a. a comparison of the a and b zymogens and their determinants for inhibition and activation
SCOP Domain Sequences for d1pca_2:
Sequence; same for both SEQRES and ATOM records: (download)
>d1pca_2 d.58.3.1 (4A-99A) Procarboxypeptidase A {Pig (Sus scrofa)}
kedfvghqvlrisvddeaqvqkvkeledlehlqldfwrgparpgfpidvrvpfpsiqavk
vfleahgirytimiedvqllldeeqeqmfasqgr
SCOP Domain Coordinates for d1pca_2:
Click to download the PDB-style file with coordinates for d1pca_2.
(The format of our PDB-style files is described here.)
(The format of our PDB-style files is described here.)
Timeline for d1pca_2:
- d1pca_2 appears in SCOP 1.57
- d1pca_2 appears in the current release, SCOPe 2.08, called d1pcaa1
View in 3D
