Lineage for d6krzf_ (6krz F:)

  1. Root: SCOPe 2.07
  2. 2352458Class b: All beta proteins [48724] (178 folds)
  3. 2352459Fold b.1: Immunoglobulin-like beta-sandwich [48725] (33 superfamilies)
    sandwich; 7 strands in 2 sheets; greek-key
    some members of the fold have additional strands
  4. 2352460Superfamily b.1.1: Immunoglobulin [48726] (5 families) (S)
  5. 2352461Family b.1.1.1: V set domains (antibody variable domain-like) [48727] (33 proteins)
  6. 2355068Protein automated matches [190119] (22 species)
    not a true protein
  7. 2356330Species Mouse (Mus musculus) [TaxId:10090] [186842] (212 PDB entries)
  8. 2356609Domain d6krzf_: 6krz F: [390588]
    automated match to d3wxwh_
    complexed with ola, olb, po4, zn; mutant

Details for d6krzf_

PDB Entry: 6krz (more details), 3.05 Å

PDB Description: crystal structure of the human adiponectin receptor 1 d208a mutant
PDB Compounds: (F:) The heavy chain variable domain (Antibody)

SCOPe Domain Sequences for d6krzf_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6krzf_ b.1.1.1 (F:) automated matches {Mouse (Mus musculus) [TaxId: 10090]}
evllqqsgpelvkpgasvritckasgytftdfnmdwvkqspgkslewigdfnpnsggsiy
nqkfkdkatftvdkssstaymelrsltfedtavyycaretgtawfaywgqgtlvtvsaa

SCOPe Domain Coordinates for d6krzf_:

Click to download the PDB-style file with coordinates for d6krzf_.
(The format of our PDB-style files is described here.)

Timeline for d6krzf_: