Lineage for d2at1b1 (2at1 B:8-100)

  1. Root: SCOPe 2.04
  2. 1631855Class d: Alpha and beta proteins (a+b) [53931] (380 folds)
  3. 1650133Fold d.58: Ferredoxin-like [54861] (59 superfamilies)
    alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2
  4. 1650481Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (2 families) (S)
    automatically mapped to Pfam PF01948
  5. 1650482Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)
  6. 1650483Protein Aspartate carbamoyltransferase [54895] (3 species)
  7. 1650484Species Escherichia coli [TaxId:562] [54896] (60 PDB entries)
    Uniprot P00478
  8. 1650575Domain d2at1b1: 2at1 B:8-100 [39051]
    Other proteins in same PDB: d2at1a1, d2at1a2, d2at1b2, d2at1c1, d2at1c2, d2at1d2
    complexed with mal, pct, zn

Details for d2at1b1

PDB Entry: 2at1 (more details), 2.8 Å

PDB Description: crystal structures of phosphonoacetamide ligated t and phosphonoacetamide and malonate ligated r states of aspartate carbamoyltransferase at 2.8-angstroms resolution and neutral ph
PDB Compounds: (B:) Aspartate carbamoyltransferase regulatory chain

SCOPe Domain Sequences for d2at1b1:

Sequence; same for both SEQRES and ATOM records: (download)

>d2at1b1 d.58.2.1 (B:8-100) Aspartate carbamoyltransferase {Escherichia coli [TaxId: 562]}
gveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlikientfls
edqvdqlalyapqatvnridnyevvgksrpslp

SCOPe Domain Coordinates for d2at1b1:

Click to download the PDB-style file with coordinates for d2at1b1.
(The format of our PDB-style files is described here.)

Timeline for d2at1b1: