SCOP 1.59: Domain d1d09b1: 1d09 B:1-100

Lineage for d1d09b1 (1d09 B:1-100)

1. Root: SCOP 1.59

2. Class d: Alpha and beta proteins (a+b) [53931] (208 folds)

3. Fold d.58: Ferredoxin-like [54861] (39 superfamilies)

4. Superfamily d.58.2: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54893] (1 family)

5. Family d.58.2.1: Aspartate carbamoyltransferase, Regulatory-chain, N-terminal domain [54894] (1 protein)

6. Protein Aspartate carbamoyltransferase [54895] (1 species)

7. Species Escherichia coli [TaxId:562] [54896] (26 PDB entries)

8. Domain d1d09b1: 1d09 B:1-100 [39015]
   Other proteins in same PDB: d1d09a1, d1d09a2, d1d09b2, d1d09c1, d1d09c2, d1d09d2

Details for d1d09b1

PDB Entry: 1d09, 2.1 Å

PDB Description: aspartate transcarbamoylase complexed with n-phosphonacetyl-l-aspartate (pala)

SCOP Domain Sequences for d1d09b1:

Sequence; same for both SEQRES and ATOM records:

>d1d09b1 d.58.2.1 (B:1-100) Aspartate carbamoyltransferase {Escherichia coli}
mthdnklqveaikrgtvidhipaqigfkllslfkltetdqritiglnlpsgemgrkdlik
ientflsedqvdqlalyapqatvnridnyevvgksrpslp

Timeline for d1d09b1:

• d1d09b1 first appeared (with stable ids) in SCOP 1.55
  
• d1d09b1 appears in SCOP 1.57
  
• d1d09b1 appears in SCOP 1.61
  
• d1d09b1 appears in the current release, SCOPe 2.08