SCOPe 2.08: Domain d1feha3: 1feh A:127-209

Lineage for d1feha3 (1feh A:127-209)

1. Root: SCOPe 2.08

2. Class d: Alpha and beta proteins (a+b) [53931] (396 folds)

3. Fold d.58: Ferredoxin-like [54861] (62 superfamilies)
   alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2

4. Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families)

5. Family d.58.1.5: Ferredoxin domains from multidomain proteins [54884] (14 proteins)
   members of this "family" may be more closely related to other ferredoxins than to each other
   in the multi-domain class (e), this applies to domains with different numbers of (sub)domains than the most common domain
   

6. Protein Fe-only hydrogenase, second domain [54885] (1 species)

7. Species Clostridium pasteurianum [TaxId:1501] [54886] (7 PDB entries)

8. Domain d1feha3: 1feh A:127-209 [38998]
   Other proteins in same PDB: d1feha1, d1feha2
   complexed with fes, hc1, sf4

Details for d1feha3

PDB Entry: 1feh, 1.8 Å

PDB Description: fe-only hydrogenase from clostridium pasteurianum

PDB Compounds: (A:) protein (periplasmic hydrogenase 1)

SCOPe Domain Sequences for d1feha3:

Sequence; same for both SEQRES and ATOM records:

>d1feha3 d.58.1.5 (A:127-209) Fe-only hydrogenase, second domain {Clostridium pasteurianum [TaxId: 1501]}
kdkteyvdersksltvdrtkcllcgrcvnacgkntetyamkflnkngktiigaedekcfd
dtncllcgqciiacpvaalseks

Timeline for d1feha3:

• d1feha3 first appeared (with stable ids) in SCOP 1.55
  
• d1feha3 appears in SCOPe 2.07