Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
Fold c.1: TIM beta/alpha-barrel [51350] (33 superfamilies) contains parallel beta-sheet barrel, closed; n=8, S=8; strand order 12345678 the first seven superfamilies have similar phosphate-binding sites |
Superfamily c.1.7: NAD(P)-linked oxidoreductase [51430] (2 families) |
Family c.1.7.1: Aldo-keto reductases (NADP) [51431] (16 proteins) Common fold covers whole protein structure |
Protein Prostaglandin d2 11-ketoreductase (akr1c3) [102051] (1 species) Aldo-keto reductase family 1 member c3 |
Species Human (Homo sapiens) [TaxId:9606] [102052] (50 PDB entries) Uniprot P42330 |
Domain d7c7gb_: 7c7g B: [389912] automated match to d2fgba_ complexed with fjr, nap |
PDB Entry: 7c7g (more details), 1.86 Å
SCOPe Domain Sequences for d7c7gb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d7c7gb_ c.1.7.1 (B:) Prostaglandin d2 11-ketoreductase (akr1c3) {Human (Homo sapiens) [TaxId: 9606]} qcvklndghfmpvlgfgtyappevprskalevtklaieagfrhidsahlynneeqvglai rskiadgsvkredifytsklwstfhrpelvrpalenslkkaqldyvdlylihspmslkpg eelsptdengkvifdivdlcttweamekckdaglaksigvsnfnrrqlemilnkpglkyk pvcnqvechpyfnrsklldfckskdivlvaysalgsqrdkrwvdpnspvlledpvlcala kkhkrtpalialryqlqrgvvvlaksyneqrirqnvqvfefqltaedmkaidgldrnlhy fnsdsfashpnypysdey
Timeline for d7c7gb_: