Class d: Alpha and beta proteins (a+b) [53931] (396 folds) |
Fold d.58: Ferredoxin-like [54861] (62 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.1: 4Fe-4S ferredoxins [54862] (7 families) |
Family d.58.1.2: 7-Fe ferredoxin [54870] (3 proteins) has C-terminal extension to the common fold |
Protein Ferredoxin [54871] (3 species) |
Species Bacillus schlegelii [TaxId:1484] [54873] (4 PDB entries) |
Domain d1bwea_: 1bwe A: [38988] artificial Fe8S8 ferredoxin complexed with sf4 |
PDB Entry: 1bwe (more details)
SCOPe Domain Sequences for d1bwea_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1bwea_ d.58.1.2 (A:) Ferredoxin {Bacillus schlegelii [TaxId: 1484]} ayvitepcigtkcascvevcpvdcihegedqyyidpdvcidcgaceavcpvsaiyhedfv peewksyiqknrdffkk
Timeline for d1bwea_: