PDB entry 1bwe

View 1bwe on RCSB PDB site
Description: artificial fe8s8 ferredoxin: the d13c variant of bacillus schlegelii fe7s8 ferredoxin
Class: electron transport
Keywords: iron-sulfur protein, electron transport
Deposited on 1998-09-23, released 1998-09-30
The last revision prior to the SCOPe 2.07 freeze date was dated 2009-02-24, with a file datestamp of 2009-03-01.
Experiment type: NMR
Resolution: N/A
R-factor: N/A
AEROSPACI score: 0.02 (click here for full SPACI score report)

Chains and heterogens:

  • Chain 'A':
    Compound: protein (ferredoxin)
    Species: Bacillus schlegelii [TaxId:1484]
    Database cross-references and differences (RAF-indexed):
    • Uniprot Q45560 (0-76)
      • engineered (12)
    Domains in SCOPe 2.07: d1bwea_
  • Heterogens: SF4

PDB Chain Sequences:

  • Chain 'A':
    Sequence; same for both SEQRES and ATOM records: (download)
    >1bweA (A:)
    ayvitepcigtkcascvevcpvdcihegedqyyidpdvcidcgaceavcpvsaiyhedfv
    peewksyiqknrdffkk