Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.58: Ferredoxin-like [54861] (59 superfamilies) alpha+beta sandwich with antiparallel beta-sheet; (beta-alpha-beta)x2 |
Superfamily d.58.4: Dimeric alpha+beta barrel [54909] (24 families) dimerizes through the beta-sheet; forms beta-sheet barrel, closed (n=8, S=12); dimers may assemble in higher oligomers |
Family d.58.4.17: SOR-like [143278] (2 proteins) Pfam PF07682; duplication: consists of two similar domains |
Protein automated matches [190550] (3 species) not a true protein |
Species Sulfurisphaera tokodaii [TaxId:273063] [389262] (2 PDB entries) |
Domain d6m3xb_: 6m3x B: [389602] automated match to d3bxva_ complexed with fe |
PDB Entry: 6m3x (more details), 2.24 Å
SCOPe Domain Sequences for d6m3xb_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6m3xb_ d.58.4.17 (B:) automated matches {Sulfurisphaera tokodaii [TaxId: 273063]} pkpyvainmvevrndpktlelfgkvgpkvcmvtarhpgfvgfqnhvqigvvplgtrwgga kmemsqemhslmlmqytfwknwkdheemhkqnwanlfrlclqcadqmiwgpyeplyeivy anmplntemtdftvmvgkkfaageavsippisqpygkrvvafgehivkeglenqfeeyai ktleafrsapgflggmilkeigvsplgslqlnakgfhqiletangmdvpepvtiyeapef rnrpqryivhtewsdtnalmfglgrvliypevrqihdkvldtlvygpyirvlnpmmegty wreylneyhl
Timeline for d6m3xb_: