Lineage for d6xk2b_ (6xk2 B:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2511779Fold c.72: Ribokinase-like [53612] (3 superfamilies)
    core: 3 layers: a/b/a; mixed beta-sheet of 8 strands, order 21345678, strand 7 is antiparallel to the rest
    potential superfamily: members of this fold have similar functions but different ATP-binding sites
  4. 2511780Superfamily c.72.1: Ribokinase-like [53613] (6 families) (S)
    has extra strand located between strands 2 and 3
  5. 2512071Family c.72.1.0: automated matches [191321] (1 protein)
    not a true family
  6. 2512072Protein automated matches [190117] (50 species)
    not a true protein
  7. 2512134Species Cryptococcus neoformans [TaxId:235443] [351144] (2 PDB entries)
  8. 2512137Domain d6xk2b_: 6xk2 B: [389563]
    automated match to d4xdaa_
    complexed with adp, edo, na

Details for d6xk2b_

PDB Entry: 6xk2 (more details), 2.5 Å

PDB Description: crystal structure of ribokinase from cryptococcus neoformans var. grubii serotype a in complex with adp
PDB Compounds: (B:) ribokinase

SCOPe Domain Sequences for d6xk2b_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6xk2b_ c.72.1.0 (B:) automated matches {Cryptococcus neoformans [TaxId: 235443]}
ssrclvrgsvnideffhlphivrpgetisstgltkraggkganqafavaraggqveldga
igddgiwvkemlesagvgtdklkivkdevtgraviqsaadgensivlhaganyylpsptp
ttslatythllvqnevplsstlayltaagqssppltsvfnpspmltpaqlrefpwkhlsw
livnegelgdlllafgssanpgeakedelqakasagilelhendyfsknvgiictlgakg
ilcyepgkevgylpaaklqnpvkdttgagdcfagyfvaglmsgkslqdalktclvacgic
venegamesvptlnavkerl

SCOPe Domain Coordinates for d6xk2b_:

Click to download the PDB-style file with coordinates for d6xk2b_.
(The format of our PDB-style files is described here.)

Timeline for d6xk2b_: