SCOPe 2.07: Domain d6txrc2: 6txr C:151-316

Lineage for d6txrc2 (6txr C:151-316)

1. Root: SCOPe 2.07

2. Class d: Alpha and beta proteins (a+b) [53931] (388 folds)

3. Fold d.162: LDH C-terminal domain-like [56326] (1 superfamily)
   unusual fold, defines family

4. Superfamily d.162.1: LDH C-terminal domain-like [56327] (3 families)

5. Family d.162.1.1: Lactate & malate dehydrogenases, C-terminal domain [56328] (5 proteins)
   N-terminal domain is NAD-binding module (alpha/beta Rossmann-fold domain)
   automatically mapped to Pfam PF02866

6. Protein automated matches [226882] (10 species)
   not a true protein

7. Species Plasmodium vivax [TaxId:5855] [389428] (1 PDB entry)

8. Domain d6txrc2: 6txr C:151-316 [389429]
   Other proteins in same PDB: d6txra1, d6txrb1, d6txrc1, d6txrd1
   automated match to d5hs4a2
   complexed with da, dc, dg, du, o0q

Details for d6txrc2

PDB Entry: 6txr, 2.5 Å

PDB Description: structural insights into cubane-modified aptamer recognition of a malaria biomarker

PDB Compounds: (C:) l-lactate dehydrogenase

SCOPe Domain Sequences for d6txrc2:

Sequence; same for both SEQRES and ATOM records:

>d6txrc2 d.162.1.1 (C:151-316) automated matches {Plasmodium vivax [TaxId: 5855]}
ggvldtsrlkyyisqklnvcprdvnalivgahgnkmvllkryitvggiplqefinnkkit
deevegifdrtvntaleivnllaspyvapaaaiiemaesylkdikkvlvcstllegqygh
snifggtplviggtgveqvielqlnaeektkfdeavaetkrmkali

Timeline for d6txrc2:

• d6txrc2 is new in SCOPe 2.07-stable
  
• d6txrc2 appears in the current release, SCOPe 2.08