Lineage for d1ghha_ (1ghh A:)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2555930Fold d.57: DNA damage-inducible protein DinI [54856] (1 superfamily)
    beta-alpha-beta(2)-alpha; 2 layers: alpha/beta; mixed sheet 213; crossing loops
  4. 2555931Superfamily d.57.1: DNA damage-inducible protein DinI [54857] (1 family) (S)
    automatically mapped to Pfam PF06183
  5. 2555932Family d.57.1.1: DNA damage-inducible protein DinI [54858] (1 protein)
  6. 2555933Protein DNA damage-inducible protein DinI [54859] (1 species)
  7. 2555934Species Escherichia coli [TaxId:562] [54860] (3 PDB entries)
  8. 2555936Domain d1ghha_: 1ghh A: [38940]

Details for d1ghha_

PDB Entry: 1ghh (more details)

PDB Description: solution structure of dini
PDB Compounds: (A:) DNA-damage-inducible protein I

SCOPe Domain Sequences for d1ghha_:

Sequence; same for both SEQRES and ATOM records: (download)

>d1ghha_ d.57.1.1 (A:) DNA damage-inducible protein DinI {Escherichia coli [TaxId: 562]}
mrievtiaktsplpagaidalagelsrriqyafpdneghvsvryaaannlsvigatkedk
qriseilqetwesaddwfvse

SCOPe Domain Coordinates for d1ghha_:

Click to download the PDB-style file with coordinates for d1ghha_.
(The format of our PDB-style files is described here.)

Timeline for d1ghha_: