Class d: Alpha and beta proteins (a+b) [53931] (388 folds) |
Fold d.57: DNA damage-inducible protein DinI [54856] (1 superfamily) beta-alpha-beta(2)-alpha; 2 layers: alpha/beta; mixed sheet 213; crossing loops |
Superfamily d.57.1: DNA damage-inducible protein DinI [54857] (1 family) automatically mapped to Pfam PF06183 |
Family d.57.1.1: DNA damage-inducible protein DinI [54858] (1 protein) |
Protein DNA damage-inducible protein DinI [54859] (1 species) |
Species Escherichia coli [TaxId:562] [54860] (3 PDB entries) |
Domain d1ghha_: 1ghh A: [38940] |
PDB Entry: 1ghh (more details)
SCOPe Domain Sequences for d1ghha_:
Sequence; same for both SEQRES and ATOM records: (download)
>d1ghha_ d.57.1.1 (A:) DNA damage-inducible protein DinI {Escherichia coli [TaxId: 562]} mrievtiaktsplpagaidalagelsrriqyafpdneghvsvryaaannlsvigatkedk qriseilqetwesaddwfvse
Timeline for d1ghha_: