Lineage for d6pqkd_ (6pqk D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2459800Fold c.9: Barstar-like [52037] (2 superfamilies)
    2 layers, a/b; parallel beta-sheet of 3 strands, order 123
  4. 2459801Superfamily c.9.1: Barstar-related [52038] (1 family) (S)
    automatically mapped to Pfam PF01337
  5. 2459802Family c.9.1.1: Barstar-related [52039] (3 proteins)
  6. 2459841Protein automated matches [190697] (2 species)
    not a true protein
  7. 2459842Species Bacillus amyloliquefaciens [TaxId:1390] [188456] (6 PDB entries)
  8. 2459844Domain d6pqkd_: 6pqk D: [389367]
    Other proteins in same PDB: d6pqka_, d6pqkc_
    automated match to d1b27d_
    protein/RNA complex; complexed with edo, po4

Details for d6pqkd_

PDB Entry: 6pqk (more details), 1.2 Å

PDB Description: cryogenic crystal structure of barnase a43c/s80c bound to barstar c40a/s59c/a67c/c82a
PDB Compounds: (D:) barstar

SCOPe Domain Sequences for d6pqkd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6pqkd_ c.9.1.1 (D:) automated matches {Bacillus amyloliquefaciens [TaxId: 1390]}
kavingeqirsisdlhqtlkkelalpeyygenldalwdaltgwveyplvlewrqfeqckq
ltengcesvlqvfreakaegaditiils

SCOPe Domain Coordinates for d6pqkd_:

Click to download the PDB-style file with coordinates for d6pqkd_.
(The format of our PDB-style files is described here.)

Timeline for d6pqkd_: