Lineage for d6lfcd_ (6lfc D:)

  1. Root: SCOPe 2.07
  2. 2434694Class c: Alpha and beta proteins (a/b) [51349] (148 folds)
  3. 2463694Fold c.23: Flavodoxin-like [52171] (15 superfamilies)
    3 layers, a/b/a; parallel beta-sheet of 5 strand, order 21345
  4. 2465640Superfamily c.23.10: SGNH hydrolase [52266] (10 families) (S)
  5. 2465694Family c.23.10.5: TAP-like [89594] (3 proteins)
    automatically mapped to Pfam PF00657
    automatically mapped to Pfam PF13472
  6. 2465705Protein automated matches [333488] (1 species)
    not a true protein
  7. 2465706Species Escherichia coli [TaxId:562] [333489] (6 PDB entries)
  8. 2465716Domain d6lfcd_: 6lfc D: [389271]
    automated match to d1ivna_
    mutant

Details for d6lfcd_

PDB Entry: 6lfc (more details), 2.7 Å

PDB Description: e. coli thioesterase i mutant dg
PDB Compounds: (D:) Acyl-CoA thioesterase I also functions as protease I

SCOPe Domain Sequences for d6lfcd_:

Sequence; same for both SEQRES and ATOM records: (download)

>d6lfcd_ c.23.10.5 (D:) automated matches {Escherichia coli [TaxId: 562]}
dtllilgdslsagyrmsasaawpallndkwqsktsvvnasisgdtsqqglarlpallkqh
qprwvlvelggndglrgfqpqqteqtlrqilqdvkaanaepllmqirlpanygrryneaf
saiypklakefdvpllpffldevglkpqwmqddgihpnrdaqpfiadwmakqlqpl

SCOPe Domain Coordinates for d6lfcd_:

Click to download the PDB-style file with coordinates for d6lfcd_.
(The format of our PDB-style files is described here.)

Timeline for d6lfcd_: