![]() | Class c: Alpha and beta proteins (a/b) [51349] (148 folds) |
![]() | Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily) core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456 The nucleotide-binding modes of this and the next two folds/superfamilies are similar |
![]() | Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families) ![]() |
![]() | Family c.2.1.0: automated matches [191313] (1 protein) not a true family |
![]() | Protein automated matches [190069] (319 species) not a true protein |
![]() | Species Pseudomonas protegens [TaxId:220664] [389052] (2 PDB entries) |
![]() | Domain d6wjaa_: 6wja A: [389053] automated match to d4ej0a_ complexed with nad, ud2; mutant |
PDB Entry: 6wja (more details), 2.09 Å
SCOPe Domain Sequences for d6wjaa_:
Sequence; same for both SEQRES and ATOM records: (download)
>d6wjaa_ c.2.1.0 (A:) automated matches {Pseudomonas protegens [TaxId: 220664]} erilvtggagfigshlvdallakgyavrvlddlstgkvgnlpmgdaglellvgdaadaal ladavqgcdavvhlaavasvqasvedpvathqsnfiatlrlceamtaagirrvvfasaaa vygnngegtpiaedtpkspltpfaadklaseyyldfyrrqhglepvilrffnifgprqdp sspysgvisifserakagrpitlfgdggqtrdfvyvadlvkilvqglespapaadatnvg lggvttlndligalqqisgkplqvshgatrsgdirhskadnrrlrerfdlgtpsslaegl erlyrsl
Timeline for d6wjaa_: