SCOPe 2.08: Domain d6wjaa_: 6wja A:

Lineage for d6wjaa_ (6wja A:)

1. Root: SCOPe 2.08

2. Class c: Alpha and beta proteins (a/b) [51349] (148 folds)

3. Fold c.2: NAD(P)-binding Rossmann-fold domains [51734] (1 superfamily)
   core: 3 layers, a/b/a; parallel beta-sheet of 6 strands, order 321456
   The nucleotide-binding modes of this and the next two folds/superfamilies are similar

4. Superfamily c.2.1: NAD(P)-binding Rossmann-fold domains [51735] (13 families)

5. Family c.2.1.0: automated matches [191313] (1 protein)
   not a true family

6. Protein automated matches [190069] (319 species)
   not a true protein

7. Species Pseudomonas protegens [TaxId:220664] [389052] (2 PDB entries)

8. Domain d6wjaa_: 6wja A: [389053]
   automated match to d4ej0a_
   complexed with nad, ud2; mutant

Details for d6wjaa_

PDB Entry: 6wja, 2.09 Å

PDB Description: udp-glcnac c4-epimerase mutant s121a/y146f from pseudomonas protegens in complex with udp-galnac

PDB Compounds: (A:) NAD-dependent epimerase/dehydratase family protein

SCOPe Domain Sequences for d6wjaa_:

Sequence; same for both SEQRES and ATOM records:

>d6wjaa_ c.2.1.0 (A:) automated matches {Pseudomonas protegens [TaxId: 220664]}
erilvtggagfigshlvdallakgyavrvlddlstgkvgnlpmgdaglellvgdaadaal
ladavqgcdavvhlaavasvqasvedpvathqsnfiatlrlceamtaagirrvvfasaaa
vygnngegtpiaedtpkspltpfaadklaseyyldfyrrqhglepvilrffnifgprqdp
sspysgvisifserakagrpitlfgdggqtrdfvyvadlvkilvqglespapaadatnvg
lggvttlndligalqqisgkplqvshgatrsgdirhskadnrrlrerfdlgtpsslaegl
erlyrsl

Timeline for d6wjaa_:

• d6wjaa_ first appeared in SCOPe 2.07