SCOP 1.71: Domain d2chr_2: 2chr 1-126

Lineage for d2chr_2 (2chr 1-126)

1. Root: SCOP 1.71

2. Class d: Alpha and beta proteins (a+b) [53931] (286 folds)

3. Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
   beta(3)-alpha(3); meander and up-and-down bundle

4. Superfamily d.54.1: Enolase N-terminal domain-like [54826] (1 family)

5. Family d.54.1.1: Enolase N-terminal domain-like [54827] (12 proteins)
   C-terminal domain is beta/alpha-barrel

6. Protein Chlormuconate cycloisomerase [54840] (2 species)

7. Species Alcaligenes eutrophus [TaxId:106590] [54841] (2 PDB entries)

8. Domain d2chr_2: 2chr 1-126 [38895]
   Other proteins in same PDB: d2chr_1
   complexed with cl, mn

Details for d2chr_2

PDB Entry: 2chr, 3 Å

PDB Description: a re-evaluation of the crystal structure of chloromuconate cycloisomerase

SCOP Domain Sequences for d2chr_2:

Sequence; same for both SEQRES and ATOM records:

>d2chr_2 d.54.1.1 (1-126) Chlormuconate cycloisomerase {Alcaligenes eutrophus}
mkidaieavivdvptkrpiqmsittvhqqsyvivrvyseglvgvgeggsvggpvwsaeca
etikiiverylaphllgtdafnvsgalqtmaravtgnasakaavemalldlkaralgvsi
aellgg

Timeline for d2chr_2:

• d2chr_2 first appeared (with stable ids) in SCOP 1.55
  
• d2chr_2 appears in SCOP 1.69
  
• d2chr_2 is called d2chra2 in SCOP 1.73
  
• d2chr_2 appears in the current release, SCOPe 2.08, called d2chra2