Lineage for d1mnsa2 (1mns A:3-132)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554473Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2554660Protein Mandelate racemase [54838] (3 species)
  7. 2554675Species Pseudomonas putida [TaxId:303] [54839] (6 PDB entries)
  8. 2554676Domain d1mnsa2: 1mns A:3-132 [38890]
    Other proteins in same PDB: d1mnsa1
    complexed with apg, mg

Details for d1mnsa2

PDB Entry: 1mns (more details), 2 Å

PDB Description: on the role of lysine 166 in the mechanism of mandelate racemase from pseudomonas putida: mechanistic and crystallographic evidence for stereospecific alkylation by (r)-alpha-phenylglycidate
PDB Compounds: (A:) mandelate racemase

SCOPe Domain Sequences for d1mnsa2:

Sequence; same for both SEQRES and ATOM records: (download)

>d1mnsa2 d.54.1.1 (A:3-132) Mandelate racemase {Pseudomonas putida [TaxId: 303]}
evlitglrtravnvplaypvhtavgtvgtaplvlidlatsagvvghsylfaytpvalksl
kqllddmaamivneplapvsleamlakrfclagytglirmaaagidmaawdalgkvhetp
lvkllganar

SCOPe Domain Coordinates for d1mnsa2:

Click to download the PDB-style file with coordinates for d1mnsa2.
(The format of our PDB-style files is described here.)

Timeline for d1mnsa2:

View in 3D
Domains from same chain:
(mouse over for more information)
d1mnsa1