Lineage for d3mucb2 (3muc B:4-130)

  1. Root: SCOPe 2.07
  2. 2530962Class d: Alpha and beta proteins (a+b) [53931] (388 folds)
  3. 2554471Fold d.54: Enolase N-terminal domain-like [54825] (1 superfamily)
    beta(3)-alpha(3); meander and up-and-down bundle
  4. 2554472Superfamily d.54.1: Enolase N-terminal domain-like [54826] (2 families) (S)
  5. 2554473Family d.54.1.1: Enolase N-terminal domain-like [54827] (15 proteins)
    C-terminal domain is beta/alpha-barrel
  6. 2554682Protein Muconate-lactonizing enzyme (cis muconate cycloisomerase) [54836] (1 species)
  7. 2554683Species Pseudomonas putida [TaxId:303] [54837] (5 PDB entries)
  8. 2554690Domain d3mucb2: 3muc B:4-130 [38888]
    Other proteins in same PDB: d3muca1, d3mucb1
    complexed with mn

Details for d3mucb2

PDB Entry: 3muc (more details), 2.3 Å

PDB Description: muconate cycloisomerase variant i54v
PDB Compounds: (B:) protein (muconate cycloisomerase)

SCOPe Domain Sequences for d3mucb2:

Sequence, based on SEQRES records: (download)

>d3mucb2 d.54.1.1 (B:4-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida [TaxId: 303]}
alieridaiivdlptirphklamhtmqqqtlvvlrvrcsdgvegigeattvgglaygyes
pegikanidahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglp
vsellgg

Sequence, based on observed residues (ATOM records): (download)

>d3mucb2 d.54.1.1 (B:4-130) Muconate-lactonizing enzyme (cis muconate cycloisomerase) {Pseudomonas putida [TaxId: 303]}
alieridaiivdlptirqqqtlvvlrvrcsdgvegigeattvgglaygyespegikanid
ahlapaliglaadninaamlkldklakgntfaksgiesalldaqgkrlglpvsellgg

SCOPe Domain Coordinates for d3mucb2:

Click to download the PDB-style file with coordinates for d3mucb2.
(The format of our PDB-style files is described here.)

Timeline for d3mucb2:

View in 3D
Domains from same chain:
(mouse over for more information)
d3mucb1